PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_8079_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family G2-like
Protein Properties Length: 188aa    MW: 19976.2 Da    PI: 10.624
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_8079_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65e-322479156
                             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                                        k+r++W+peLH+rF+ a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  cra_locus_8079_iso_1_len_881_ver_3 24 KTRRCWSPELHKRFLMALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 79
                                        68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.5512181IPR017930Myb domain
SuperFamilySSF466892.33E-182281IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-282282IPR009057Homeodomain-like
TIGRFAMsTIGR015579.6E-272479IPR006447Myb domain, plants
PfamPF002495.7E-82677IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
GGGGGGGGGN KKDEKEKETQ SARKTRRCWS PELHKRFLMA LQQLGGSHVA TPKQIRELMK  60
VDGLTNDEVK SHLQKYRLHN RRPSSSIHNN NNNPQAPQFV VVGGIWVPPP VEYAAMATTT  120
GSGGEASGGA NSNGIYAPIA TLPSPPPPQV ANKQRQQHHK QPRSCHRGSH SGGGASSSTD  180
TTTASPSY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631224.12e-69PREDICTED: probable transcription factor GLK2
TrEMBLA0A068TX101e-77A0A068TX10_COFCA; Uncharacterized protein
STRINGVIT_01s0011g03110.t015e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438